Lineage for d3ccvj1 (3ccv J:4-145)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468793Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1468869Domain d3ccvj1: 3ccv J:4-145 [156460]
    Other proteins in same PDB: d3ccv21, d3ccvb1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvp1, d3ccvr1, d3ccvs1, d3ccvy1, d3ccvz1
    automatically matched to d1w2bi_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvj1

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d3ccvj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccvj1 i.1.1.2 (J:4-145) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d3ccvj1:

Click to download the PDB-style file with coordinates for d3ccvj1.
(The format of our PDB-style files is described here.)

Timeline for d3ccvj1: