Lineage for d3ccvb1 (3ccv B:1-337)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317134Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1317304Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 1317305Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 1317346Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 1317369Domain d3ccvb1: 3ccv B:1-337 [156455]
    Other proteins in same PDB: d3ccv11, d3ccv21, d3ccv31, d3ccvd1, d3ccvf1, d3ccvh1, d3ccvi1, d3ccvj1, d3ccvk1, d3ccvl1, d3ccvn1, d3ccvo1, d3ccvp1, d3ccvq1, d3ccvr1, d3ccvs1, d3ccvt1, d3ccvu1, d3ccvv1, d3ccvw1, d3ccvx1, d3ccvy1, d3ccvz1
    automatically matched to d1jj2b_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccvb1

PDB Entry: 3ccv (more details), 2.9 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2616a
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d3ccvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ccvb1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d3ccvb1:

Click to download the PDB-style file with coordinates for d3ccvb1.
(The format of our PDB-style files is described here.)

Timeline for d3ccvb1: