Lineage for d3ccud1 (3ccu D:10-174)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249421Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1249482Domain d3ccud1: 3ccu D:10-174 [156432]
    Other proteins in same PDB: d3ccu21, d3ccub1, d3ccuf1, d3ccuh1, d3ccui1, d3ccup1, d3ccur1, d3ccus1, d3ccuy1, d3ccuz1
    automatically matched to d1w2bd_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3ccud1

PDB Entry: 3ccu (more details), 2.8 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d3ccud1:

Sequence, based on SEQRES records: (download)

>d3ccud1 i.1.1.2 (D:10-174) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d3ccud1 i.1.1.2 (D:10-174) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d3ccud1:

Click to download the PDB-style file with coordinates for d3ccud1.
(The format of our PDB-style files is described here.)

Timeline for d3ccud1: