Lineage for d3cce11 (3cce 1:1-56)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249421Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1249466Domain d3cce11: 3cce 1:1-56 [156260]
    Other proteins in same PDB: d3cce21, d3cceb1, d3ccef1, d3cceh1, d3ccei1, d3ccep1, d3ccer1, d3cces1, d3ccey1, d3ccez1
    automatically matched to d1w2bz_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cce11

PDB Entry: 3cce (more details), 2.75 Å

PDB Description: structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d3cce11:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cce11 i.1.1.2 (1:1-56) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d3cce11:

Click to download the PDB-style file with coordinates for d3cce11.
(The format of our PDB-style files is described here.)

Timeline for d3cce11: