Lineage for d1hlba_ (1hlb A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903124Protein Hemoglobin, different isoforms [46524] (1 species)
  7. 903125Species Caudina arenicola, also known as Molpadia arenicola [TaxId:7698] [46525] (2 PDB entries)
  8. 903126Domain d1hlba_: 1hlb A: [15625]
    complexed with hem

Details for d1hlba_

PDB Entry: 1hlb (more details), 2.5 Å

PDB Description: structural analysis of monomeric hemichrome and dimeric cyanomet hemoglobins from caudina arenicola
PDB Compounds: (A:) hemoglobin (deoxy)

SCOPe Domain Sequences for d1hlba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}
ggtlaiqaqgdltlaqkkivrktwhqlmrnktsfvtdvfirifaydpsaqnkfpqmagms
asqlrssrqmqahairvssimseyveeldsdilpellatlarthdlnkvgadhynlfakv
lmealqaelgsdfnektrdawakafsvvqavllvkhg

SCOPe Domain Coordinates for d1hlba_:

Click to download the PDB-style file with coordinates for d1hlba_.
(The format of our PDB-style files is described here.)

Timeline for d1hlba_: