Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (3 proteins) |
Protein Prokaryotic (50S subunit) [58125] (3 species) |
Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries) |
Domain d3cc7w1: 3cc7 W:1-154 [156240] Other proteins in same PDB: d3cc721, d3cc7b1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7p1, d3cc7r1, d3cc7s1, d3cc7y1, d3cc7z1 automatically matched to d1w2bv_ complexed with cd, cl, k, mg, na, sr; mutant |
PDB Entry: 3cc7 (more details), 2.7 Å
SCOPe Domain Sequences for d3cc7w1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cc7w1 i.1.1.2 (W:1-154) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d3cc7w1: