Lineage for d3cc7l1 (3cc7 L:1-150)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2648151Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2648286Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2648433Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2648455Domain d3cc7l1: 3cc7 L:1-150 [156230]
    Other proteins in same PDB: d3cc721, d3cc7b1, d3cc7f1, d3cc7h1, d3cc7i1, d3cc7p1, d3cc7r1, d3cc7s1, d3cc7y1, d3cc7z1
    automatically matched to d1w2bk_
    complexed with cd, cl, k, mg, na, sr; mutant

Details for d3cc7l1

PDB Entry: 3cc7 (more details), 2.7 Å

PDB Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation C2487U
PDB Compounds: (L:) 50S ribosomal protein L15P

SCOPe Domain Sequences for d3cc7l1:

Sequence, based on SEQRES records: (download)

>d3cc7l1 i.1.1.2 (L:1-150) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl
iaddfsegarekvegaggsveltdlgeerq

Sequence, based on observed residues (ATOM records): (download)

>d3cc7l1 i.1.1.2 (L:1-150) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
segarekvegaggsveltdlgeerq

SCOPe Domain Coordinates for d3cc7l1:

Click to download the PDB-style file with coordinates for d3cc7l1.
(The format of our PDB-style files is described here.)

Timeline for d3cc7l1: