Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) |
Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
Protein Thiamine monophosphate kinase (ThiL) N-terminal domain [118030] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [118031] (5 PDB entries) Uniprot O67883 |
Domain d3c9tb1: 3c9t B:1-137 [156142] Other proteins in same PDB: d3c9ta2, d3c9ta3, d3c9tb2, d3c9tb3 automated match to d3c9ta1 complexed with acp, mg, tps |
PDB Entry: 3c9t (more details), 2.6 Å
SCOPe Domain Sequences for d3c9tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9tb1 d.79.4.1 (B:1-137) Thiamine monophosphate kinase (ThiL) N-terminal domain {Aquifex aeolicus [TaxId: 63363]} mrlkelgefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni sksekigisvflvgete
Timeline for d3c9tb1: