SCOPe 2.08: Domain d3c9fb2: 3c9f B:16-337

Lineage for d3c9fb2 (3c9f B:16-337)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins)

6. Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [160868] (1 PDB entry)
   Uniprot Q5A5Q7 16-337

8. Domain d3c9fb2: 3c9f B:16-337 [156128]
   Other proteins in same PDB: d3c9fa1, d3c9fa3, d3c9fb1
   automated match to d3c9fa2
   complexed with fmt, na, zn

Details for d3c9fb2

PDB Entry: 3c9f, 1.9 Å

PDB Description: crystal structure of 5'-nucleotidase from candida albicans sc5314

PDB Compounds: (B:) 5'-nucleotidase

SCOPe Domain Sequences for d3c9fb2:

Sequence; same for both SEQRES and ATOM records:

>d3c9fb2 d.159.1.2 (B:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Yeast (Candida albicans) [TaxId: 5476]}
sfphrnltwndinfvhttdthgwysghinqplyhanwgdfisftthmrriahsrnqdlll
idsgdrhdgnglsditspnglkstpifikqdydlltignhelylwenskqeyetvvnhfq
dkyvcsnvdirldnglfvplglkykyfttpirgirvmafgflfdfkrfnsgtrvtpmaet
ihepwfqealkhevdliiivghtpishnwgefyqvhqylrqffpdtiiqyfgghshirdf
tvfdslstglqsgrycetvgwtsvnldkadlnlpvrqrfsrsyidfntdsfkyhtnldke
fdtakgklvskliretrkelkl

Timeline for d3c9fb2:

• d3c9fb2 first appeared in SCOP 1.75
  
• d3c9fb2 appears in SCOPe 2.07