SCOPe 2.06: Domain d3c87a2: 3c87 A:151-396

Lineage for d3c87a2 (3c87 A:151-396)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Enterochelin esterase, catalytic domain [142699] (1 species)

7. Species Shigella flexneri [TaxId:623] [142700] (4 PDB entries)
   Uniprot Q83SB9 151-397

8. Domain d3c87a2: 3c87 A:151-396 [156022]
   Other proteins in same PDB: d3c87a1, d3c87b1
   automated match to d2b20a2
   complexed with na, po4

Details for d3c87a2

PDB Entry: 3c87, 2.17 Å

PDB Description: Crystal structure of the enterobactin esterase FES from Shigella flexneri in the presence of enterobactin

PDB Compounds: (A:) enterochelin esterase

SCOPe Domain Sequences for d3c87a2:

Sequence, based on SEQRES records:

>d3c87a2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagev
saeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglid
lwqplf

Sequence, based on observed residues (ATOM records):

>d3c87a2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrqqegvlleklkagevsa
eglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlw
qplf

Timeline for d3c87a2:

• d3c87a2 first appeared in SCOP 1.75
  
• d3c87a2 appears in SCOPe 2.05
  
• d3c87a2 appears in SCOPe 2.07
  
• d3c87a2 appears in the current release, SCOPe 2.08