Lineage for d3c2ma2 (3c2m A:92-148)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1090417Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1091050Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1091051Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 1091052Protein DNA polymerase beta [81579] (2 species)
  7. 1091053Species Human (Homo sapiens) [TaxId:9606] [81575] (107 PDB entries)
  8. 1091063Domain d3c2ma2: 3c2m A:92-148 [155883]
    Other proteins in same PDB: d3c2ma1, d3c2ma3
    automatically matched to d1bpxa3
    protein/DNA complex; complexed with edo, f2a, mn, na

Details for d3c2ma2

PDB Entry: 3c2m (more details), 2.15 Å

PDB Description: ternary complex of dna polymerase beta with a g:dapcpp mismatch in the active site
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3c2ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2ma2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d3c2ma2:

Click to download the PDB-style file with coordinates for d3c2ma2.
(The format of our PDB-style files is described here.)

Timeline for d3c2ma2: