Lineage for d3c1ch1 (3c1c H:1429-1520)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698177Protein Histone H2B [47119] (6 species)
  7. 2698289Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [158385] (3 PDB entries)
  8. 2698293Domain d3c1ch1: 3c1c H:1429-1520 [155864]
    Other proteins in same PDB: d3c1cb1, d3c1cc1, d3c1cf1, d3c1cg1
    automatically matched to d1s32d_
    protein/DNA complex

Details for d3c1ch1

PDB Entry: 3c1c (more details), 3.15 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
PDB Compounds: (H:) Histone 2, H2bf

SCOPe Domain Sequences for d3c1ch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c1ch1 a.22.1.1 (H:1429-1520) Histone H2B {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkyts

SCOPe Domain Coordinates for d3c1ch1:

Click to download the PDB-style file with coordinates for d3c1ch1.
(The format of our PDB-style files is described here.)

Timeline for d3c1ch1: