Lineage for d3c04a1 (3c04 A:6-154)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910124Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)
  6. 2910207Protein Phosphomannomutase/phosphoglucomutase, N-terminal domain [419008] (1 species)
  7. 2910208Species Pseudomonas aeruginosa [TaxId:287] [419480] (12 PDB entries)
  8. 2910215Domain d3c04a1: 3c04 A:6-154 [155803]
    Other proteins in same PDB: d3c04a2, d3c04a3, d3c04a4
    automated match to d1k2yx1
    complexed with zn; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d3c04a1

PDB Entry: 3c04 (more details), 2.2 Å

PDB Description: structure of the p368g mutant of pmm/pgm from p. aeruginosa
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d3c04a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c04a1 c.84.1.1 (A:6-154) Phosphomannomutase/phosphoglucomutase, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelv
kqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvaget
laneqiqalreriekndlasgvgsveqvd

SCOPe Domain Coordinates for d3c04a1:

Click to download the PDB-style file with coordinates for d3c04a1.
(The format of our PDB-style files is described here.)

Timeline for d3c04a1: