Lineage for d3bzua1 (3bzu A:25-287)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819766Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 819770Species Human (Homo sapiens) [TaxId:9606] [117424] (11 PDB entries)
    Uniprot P28845
  8. 819787Domain d3bzua1: 3bzu A:25-287 [155788]
    automatically matched to d1xu9b_
    complexed with a21, nap; mutant

Details for d3bzua1

PDB Entry: 3bzu (more details), 2.25 Å

PDB Description: crystal structure of human 11-beta-hydroxysteroid dehydrogenase(hsd1) in complex with nadp and thiazolone inhibitor
PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOP Domain Sequences for d3bzua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzua1 c.2.1.2 (A:25-287) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
eefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa
sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf
lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs
rvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwt
tllirnpsrkileflystsynmd

SCOP Domain Coordinates for d3bzua1:

Click to download the PDB-style file with coordinates for d3bzua1.
(The format of our PDB-style files is described here.)

Timeline for d3bzua1: