Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (7 PDB entries) |
Domain d3bvdb1: 3bvd B:37-168 [155660] Other proteins in same PDB: d3bvdb2, d3bvdc1 automatically matched to d2cuab_ complexed with cu, cua, has, hem, xe |
PDB Entry: 3bvd (more details), 3.37 Å
SCOPe Domain Sequences for d3bvdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvdb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg hqnmfgtivvke
Timeline for d3bvdb1: