SCOPe 2.08: Domain d3buod2: 3buo D:48-177

Lineage for d3buod2 (3buo D:48-177)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.48: N-cbl like [47667] (5 superfamilies)
   4 helices; bundle, left-handed twist; left-handed superhelix

4. Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families)
   automatically mapped to Pfam PF02262

5. Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)

6. Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries)

8. Domain d3buod2: 3buo D:48-177 [155633]
   Other proteins in same PDB: d3buob1, d3buob3, d3buod1, d3buod3
   automatically matched to d1b47a2

Details for d3buod2

PDB Entry: 3buo, 2.6 Å

PDB Description: crystal structure of c-cbl-tkb domain complexed with its binding motif in egf receptor'

PDB Compounds: (D:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d3buod2:

Sequence; same for both SEQRES and ATOM records:

>d3buod2 a.48.1.1 (D:48-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
ifpsglfqgd

Timeline for d3buod2:

• d3buod2 first appeared in SCOP 1.75
  
• d3buod2 appears in SCOPe 2.07