Lineage for d3bula1 (3bul A:651-740)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1736770Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 1736771Superfamily a.46.1: Methionine synthase domain [47644] (1 family) (S)
    automatically mapped to Pfam PF02607
  5. 1736772Family a.46.1.1: Methionine synthase domain [47645] (1 protein)
  6. 1736773Protein Methionine synthase domain [47646] (1 species)
  7. 1736774Species Escherichia coli [TaxId:562] [47647] (5 PDB entries)
  8. 1736775Domain d3bula1: 3bul A:651-740 [155620]
    Other proteins in same PDB: d3bula2, d3bula3
    complexed with b12

Details for d3bula1

PDB Entry: 3bul (more details), 2.3 Å

PDB Description: e. coli i690c/g743c meth c-terminal fragment (649-1227)
PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d3bula1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bula1 a.46.1.1 (A:651-740) Methionine synthase domain {Escherichia coli [TaxId: 562]}
qaewrswevnkrleyslvkgitefieqdteearqqatrpceviegplmdgmnvvgdlfge
gkmflpqvvksarvmkqavaylepfieask

SCOPe Domain Coordinates for d3bula1:

Click to download the PDB-style file with coordinates for d3bula1.
(The format of our PDB-style files is described here.)

Timeline for d3bula1: