Lineage for d3btla2 (3btl A:73-187)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011636Protein Multidrug binding protein QacR [69107] (1 species)
  7. 2011637Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 2011656Domain d3btla2: 3btl A:73-187 [155583]
    Other proteins in same PDB: d3btla1, d3btlb1, d3btld1, d3btle1
    automatically matched to d1jt0a2
    complexed with mgr, so4

Details for d3btla2

PDB Entry: 3btl (more details), 2.9 Å

PDB Description: crystal structure of qacr(e58q) bound to malachite green
PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3btla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btla2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d3btla2:

Click to download the PDB-style file with coordinates for d3btla2.
(The format of our PDB-style files is described here.)

Timeline for d3btla2: