SCOPe 2.02: Domain d2mhbb_: 2mhb B:

Lineage for d2mhbb_ (2mhb B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46504] (15 PDB entries)

8. Domain d2mhbb_: 2mhb B: [15555]
   Other proteins in same PDB: d2mhba_
   complexed with hem

Details for d2mhbb_

PDB Entry: 2mhb, 2 Å

PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution

PDB Compounds: (B:) hemoglobin (aquo met) (beta chain)

SCOPe Domain Sequences for d2mhbb_:

Sequence; same for both SEQRES and ATOM records:

>d2mhbb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

Timeline for d2mhbb_:

• d2mhbb_ first appeared (with stable ids) in SCOP 1.55
  
• d2mhbb_ appears in SCOPe 2.01
  
• d2mhbb_ appears in SCOPe 2.03
  
• d2mhbb_ appears in the current release, SCOPe 2.08