Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
Protein Sarcosine oxidase [51920] (1 species) |
Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (13 PDB entries) |
Domain d3bhkb1: 3bhk B:1-217,B:322-381 [155273] Other proteins in same PDB: d3bhka2, d3bhkb2 automatically matched to d1el5a1 complexed with cl, fad, gol; mutant |
PDB Entry: 3bhk (more details), 1.71 Å
SCOPe Domain Sequences for d3bhkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bhkb1 c.3.1.2 (B:1-217,B:322-381) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtkiirhaygegre yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs ghgfkfssgvgevlsqlaltgktehdisifsinrpalk
Timeline for d3bhkb1: