Class b: All beta proteins [48724] (176 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins) |
Protein Zn-dependent arginine carboxypeptidase [159343] (1 species) |
Species Unidentified organism [TaxId:32644] [159344] (2 PDB entries) |
Domain d3be7f1: 3be7 F:4-56,F:360-398 [155173] Other proteins in same PDB: d3be7a2, d3be7b2, d3be7c2, d3be7d2, d3be7e2, d3be7f2, d3be7g2, d3be7h2 automatically matched to 3BE7 A:3-56,A:360-400 complexed with arg, gol, mg |
PDB Entry: 3be7 (more details), 2.3 Å
SCOPe Domain Sequences for d3be7f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3be7f1 b.92.1.9 (F:4-56,F:360-398) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]} edflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipXqikegf dadivgvienplanirtleevafvmkegkvykr
Timeline for d3be7f1: