Lineage for d3bbns1 (3bbn S:3-85)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3043318Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species)
  7. 3043319Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries)
  8. 3043327Domain d3bbns1: 3bbn S:3-85 [155080]

Details for d3bbns1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (S:) ribosomal protein s19

SCOPe Domain Sequences for d3bbns1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbns1 i.1.1.1 (S:3-85) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
rslkknpfvanhllrkieklnkkaekeiivtwsrastiiptmightiaihngrehlpiyi
tdrmvghklgefaptlnfrghak

SCOPe Domain Coordinates for d3bbns1:

Click to download the PDB-style file with coordinates for d3bbns1.
(The format of our PDB-style files is described here.)

Timeline for d3bbns1: