![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (26 families) ![]() |
![]() | Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
![]() | Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63610] (45 PDB entries) Uniprot P09960 |
![]() | Domain d3b7sa1: 3b7s A:461-610 [154940] Other proteins in same PDB: d3b7sa2, d3b7sa3 automated match to d3b7sa1 complexed with acy, gol, yb, zn |
PDB Entry: 3b7s (more details), 1.47 Å
SCOPe Domain Sequences for d3b7sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7sa1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d3b7sa1: