Lineage for d3b6od_ (3b6o D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1172062Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1172752Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1172753Protein automated matches [190396] (3 species)
    not a true protein
  7. 1172754Species Mouse (Mus musculus) [TaxId:10090] [187264] (5 PDB entries)
  8. 1172758Domain d3b6od_: 3b6o D: [154904]
    automated match to d1y97a1
    protein/DNA complex; complexed with li, tmp

Details for d3b6od_

PDB Entry: 3b6o (more details), 2.1 Å

PDB Description: Structure of TREX1 in complex with a nucleotide and an inhibitor ion (lithium)
PDB Compounds: (D:) Three prime repair exonuclease 1

SCOPe Domain Sequences for d3b6od_:

Sequence, based on SEQRES records: (download)

>d3b6od_ c.55.3.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiytrlyw
qaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg

Sequence, based on observed residues (ATOM records): (download)

>d3b6od_ c.55.3.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprvvdkls
lciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahngdr
ydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdshta
egdvltllsicqwkpqallqwvdeharpfstvkpmyg

SCOPe Domain Coordinates for d3b6od_:

Click to download the PDB-style file with coordinates for d3b6od_.
(The format of our PDB-style files is described here.)

Timeline for d3b6od_: