Lineage for d2zqob_ (2zqo B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 951778Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 951779Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 951780Protein 29-kDa galactose-binding lectin [159148] (1 species)
    duplication: tadem repeat of two Ricin B-like domains
  7. 951781Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [159149] (2 PDB entries)
    Uniprot O96048 131-260
  8. 951783Domain d2zqob_: 2zqo B: [154766]
    automated match to d2zqna1
    complexed with cd, imd, nga, po4

Details for d2zqob_

PDB Entry: 2zqo (more details), 1.8 Å

PDB Description: crystal structure of the earthworm r-type lectin c-half in complex with galnac
PDB Compounds: (B:) 29-kDa galactose-binding lectin

SCOPe Domain Sequences for d2zqob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zqob_ b.42.2.1 (B:) 29-kDa galactose-binding lectin {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
pkffyikselngkvldiegqnpapgskiitwdqkkgptavnqlwytdqqgvirsklndfa
idasheqietqpfdpnnpkrawivsgntiaqlsdrdivldiiksdkeagahicawkqhgg
pnqkfiiese

SCOPe Domain Coordinates for d2zqob_:

Click to download the PDB-style file with coordinates for d2zqob_.
(The format of our PDB-style files is described here.)

Timeline for d2zqob_: