SCOPe 2.08: Domain d2zozb2: 2zoz B:74-175

Lineage for d2zozb2 (2zoz B:74-175)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Transcriptional regulator Cgl2612 [140895] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [140896] (5 PDB entries)
   Uniprot Q8NMG3 75-175

8. Domain d2zozb2: 2zoz B:74-175 [154743]
   Other proteins in same PDB: d2zoza1, d2zozb1, d2zozb3
   automated match to d2zoza2
   complexed with et, gol, so4

Details for d2zozb2

PDB Entry: 2zoz, 1.95 Å

PDB Description: Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor CgmR

PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d2zozb2:

Sequence; same for both SEQRES and ATOM records:

>d2zozb2 a.121.1.1 (B:74-175) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
pedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahk
ravylvqlaadglfvhdyihddvlskskrqamletilelips

Timeline for d2zozb2:

• d2zozb2 first appeared in SCOP 1.75
  
• d2zozb2 appears in SCOPe 2.07