Lineage for d2zokd_ (2zok D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1290588Protein beta2-microglobulin [88600] (5 species)
  7. 1291129Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
    Uniprot P01887
  8. 1291199Domain d2zokd_: 2zok D: [154727]
    Other proteins in same PDB: d2zoka1, d2zoka2, d2zokc1, d2zokc2, d2zoke1, d2zoke2, d2zokg1, d2zokg2
    automated match to d1bz9b_
    complexed with gol, so4

Details for d2zokd_

PDB Entry: 2zok (more details), 2.1 Å

PDB Description: crystal structure of h-2db in complex with jhmv epitope s510
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d2zokd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zokd_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d2zokd_:

Click to download the PDB-style file with coordinates for d2zokd_.
(The format of our PDB-style files is described here.)

Timeline for d2zokd_: