Lineage for d2zlel1 (2zle L:4521-4619)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1122931Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)
  6. 1122937Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
    duplication: tandem repeat of two PDZ domains
  7. 1122938Species Escherichia coli [TaxId:562] [74935] (3 PDB entries)
  8. 1122964Domain d2zlel1: 2zle L:4521-4619 [154662]
    Other proteins in same PDB: d2zlea3, d2zleb3, d2zlec3, d2zlee3, d2zlef3, d2zleg3, d2zleh3, d2zlei3, d2zlej3, d2zlek3, d2zlel3, d2zlem3
    automatically matched to d1ky9b1

Details for d2zlel1

PDB Entry: 2zle (more details), 28 Å

PDB Description: cryo-em structure of degp12/omp
PDB Compounds: (L:) Protease do

SCOPe Domain Sequences for d2zlel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zlel1 b.36.1.4 (L:4521-4619) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
vkrgelgimgtelnselakamkvdaqrgafvsqvlpnssaakagikagdvitslngkpis
sfaalraqvgtmpvgskltlgllrdgkqvnvnlelqqss

SCOPe Domain Coordinates for d2zlel1:

Click to download the PDB-style file with coordinates for d2zlel1.
(The format of our PDB-style files is described here.)

Timeline for d2zlel1: