Lineage for d2zjqn1 (2zjq N:2-118)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017239Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2017277Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2017278Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2017279Protein Ribosomal protein L20 [74733] (4 species)
  7. 2017282Species Deinococcus radiodurans [TaxId:1299] [158512] (6 PDB entries)
    Uniprot Q9RSW7 2-118
  8. 2017286Domain d2zjqn1: 2zjq N:2-118 [154538]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR N:2-118
    protein/RNA complex

Details for d2zjqn1

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (N:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2zjqn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjqn1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOPe Domain Coordinates for d2zjqn1:

Click to download the PDB-style file with coordinates for d2zjqn1.
(The format of our PDB-style files is described here.)

Timeline for d2zjqn1: