SCOPe 2.07: Domain d2zfda_: 2zfd A:

Lineage for d2zfda_ (2zfd A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcineurin B-like protein 2 [101182] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [101183] (2 PDB entries)

8. Domain d2zfda_: 2zfd A: [154406]
   automated match to d1uhna_
   complexed with acy, ca

Details for d2zfda_

PDB Entry: 2zfd, 1.2 Å

PDB Description: The crystal structure of plant specific calcium binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14

PDB Compounds: (A:) calcineurin B-like protein 2

SCOPe Domain Sequences for d2zfda_:

Sequence; same for both SEQRES and ATOM records:

>d2zfda_ a.39.1.5 (A:) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf
dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat
laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit
ttf

Timeline for d2zfda_:

• d2zfda_ first appeared in SCOP 1.75, called d2zfda1
  
• d2zfda_ appears in SCOPe 2.06
  
• d2zfda_ appears in the current release, SCOPe 2.08