SCOPe 2.03: Domain d2zc3f1: 2zc3 F:631-692

Lineage for d2zc3f1 (2zc3 F:631-692)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
   alpha1-beta3; 2 layers: alpha/beta; order 132

4. Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family)
   duplication: consists of 2 subdomains of this fold

5. Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)

6. Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)

8. Domain d2zc3f1: 2zc3 F:631-692 [154328]
   Other proteins in same PDB: d2zc3b1, d2zc3e1
   automatically matched to d1pmda1
   complexed with bmg, so4

Details for d2zc3f1

PDB Entry: 2zc3, 2.5 Å

PDB Description: Penicillin-binding protein 2X (PBP 2X) acyl-enzyme complex (biapenem) from Streptococcus pneumoniae

PDB Compounds: (F:) penicillin-binding protein 2x

SCOPe Domain Sequences for d2zc3f1:

Sequence; same for both SEQRES and ATOM records:

>d2zc3f1 d.11.1.1 (F:631-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
sqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlils
dk

Timeline for d2zc3f1:

• d2zc3f1 first appeared in SCOP 1.75
  
• d2zc3f1 appears in SCOPe 2.02
  
• d2zc3f1 appears in SCOPe 2.04
  
• d2zc3f1 appears in the current release, SCOPe 2.08