Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) duplication: consists of 2 subdomains of this fold |
Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
Species Streptococcus pneumoniae [TaxId:1313] [54187] (10 PDB entries) |
Domain d2zc3f1: 2zc3 F:631-692 [154328] Other proteins in same PDB: d2zc3b1, d2zc3e1 automatically matched to d1pmda1 complexed with bmg, so4 |
PDB Entry: 2zc3 (more details), 2.5 Å
SCOP Domain Sequences for d2zc3f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zc3f1 d.11.1.1 (F:631-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} sqqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlils dk
Timeline for d2zc3f1:
View in 3D Domains from other chains: (mouse over for more information) d2zc3b1, d2zc3c1, d2zc3c2, d2zc3e1 |