Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries) |
Domain d2zc3e_: 2zc3 E: [154327] Other proteins in same PDB: d2zc3c1, d2zc3c2, d2zc3f1, d2zc3f2 automated match to d2zc4b1 complexed with bmg, so4 |
PDB Entry: 2zc3 (more details), 2.5 Å
SCOPe Domain Sequences for d2zc3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zc3e_ e.3.1.1 (E:) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} rtmdgkdvyttissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdad tkegitedfvwrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatird wdvnegltggrmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdey agqlpadnivniaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtark sqkeivgnpvskdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqi adeknggylvgltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasa mkdslnl
Timeline for d2zc3e_: