Lineage for d2z9oa2 (2z9o A:144-251)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721690Family a.4.5.10: Replication initiation protein [46816] (3 proteins)
    duplication: tandem repeat of two "winged helix" domains arranged with the pseudo twofold symmetry
  6. 1721691Protein RepE54 [46817] (1 species)
  7. 1721692Species Escherichia coli, mini-F plasmid [TaxId:562] [46818] (2 PDB entries)
  8. 1721696Domain d2z9oa2: 2z9o A:144-251 [154261]
    automated match to d1repc2
    protein/DNA complex

Details for d2z9oa2

PDB Entry: 2z9o (more details), 3.14 Å

PDB Description: Crystal structure of the dimeric form of RepE in complex with the repE operator DNA
PDB Compounds: (A:) Replication initiation protein

SCOPe Domain Sequences for d2z9oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9oa2 a.4.5.10 (A:144-251) RepE54 {Escherichia coli, mini-F plasmid [TaxId: 562]}
nrftqfrlsetkeitnpyamrlyeslcqyrkpdgsgivslkidwiieryqlpqsyqrmpd
frrrflqvcvneinsrtpmrlsyiekkkgrqtthivfsfrditsmttg

SCOPe Domain Coordinates for d2z9oa2:

Click to download the PDB-style file with coordinates for d2z9oa2.
(The format of our PDB-style files is described here.)

Timeline for d2z9oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z9oa1