Lineage for d2z9kb1 (2z9k B:2-301)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 803590Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 803620Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (3 species)
    contains an extra alpha-helical domain
  7. 803624Species SARS coronavirus [TaxId:227859] [89349] (20 PDB entries)
  8. 803633Domain d2z9kb1: 2z9k B:2-301 [154257]
    automatically matched to d1q2wb_
    complexed with dms, doz

Details for d2z9kb1

PDB Entry: 2z9k (more details), 1.85 Å

PDB Description: Complex structure of SARS-CoV 3C-like protease with JMF1600
PDB Compounds: (B:) 3C-like proteinase

SCOP Domain Sequences for d2z9kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z9kb1 b.47.1.4 (B:2-301) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs

SCOP Domain Coordinates for d2z9kb1:

Click to download the PDB-style file with coordinates for d2z9kb1.
(The format of our PDB-style files is described here.)

Timeline for d2z9kb1: