SCOPe 2.05: Domain d2z91d2: 2z91 D:108-213

Lineage for d2z91d2 (2z91 D:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d2z91d2: 2z91 D:108-213 [154224]
   Other proteins in same PDB: d2z91a1, d2z91b1, d2z91c1, d2z91d1
   automated match to d1h3pl2

Details for d2z91d2

PDB Entry: 2z91, 2.6 Å

PDB Description: Crystal structure of the Fab fragment of anti-ciguatoxin antibody 10C9

PDB Compounds: (D:) Anti-ciguatoxin antibody 10C9 Fab light chain

SCOPe Domain Sequences for d2z91d2:

Sequence, based on SEQRES records:

>d2z91d2 b.1.1.2 (D:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Sequence, based on observed residues (ATOM records):

>d2z91d2 b.1.1.2 (D:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgrqngvlnswtdqdsk
dstysmsstltltkdeyerhnsytceathktspivksfnrne

Timeline for d2z91d2:

• d2z91d2 first appeared in SCOP 1.75
  
• d2z91d2 appears in SCOPe 2.04
  
• d2z91d2 appears in SCOPe 2.06
  
• d2z91d2 appears in the current release, SCOPe 2.08