Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
Protein Superantigen-like protein SET3 [74946] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [74947] (3 PDB entries) |
Domain d2z8la1: 2z8l A:13-100 [154209] Other proteins in same PDB: d2z8la2 automated match to d1m4va1 complexed with gol, po4 |
PDB Entry: 2z8l (more details), 1.65 Å
SCOPe Domain Sequences for d2z8la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z8la1 b.40.2.2 (A:13-100) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]} difdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdierlktrknpg ldifvvkeaenrngtvfsyggvtkknqg
Timeline for d2z8la1: