Lineage for d2z8la1 (2z8l A:13-100)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314261Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1314415Protein Superantigen-like protein SET3 [74946] (1 species)
  7. 1314416Species Staphylococcus aureus [TaxId:1280] [74947] (3 PDB entries)
  8. 1314417Domain d2z8la1: 2z8l A:13-100 [154209]
    Other proteins in same PDB: d2z8la2
    automatically matched to d1m4va1
    complexed with gol, po4

Details for d2z8la1

PDB Entry: 2z8l (more details), 1.65 Å

PDB Description: crystal structure of the staphylococcal superantigen-like protein ssl5 at ph 4.6 complexed with sialyl lewis x
PDB Compounds: (A:) Exotoxin 3

SCOPe Domain Sequences for d2z8la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z8la1 b.40.2.2 (A:13-100) Superantigen-like protein SET3 {Staphylococcus aureus [TaxId: 1280]}
difdlrdyysgaskelknvtgyryskggkhylifdkhqkftriqifgkdierlktrknpg
ldifvvkeaenrngtvfsyggvtkknqg

SCOPe Domain Coordinates for d2z8la1:

Click to download the PDB-style file with coordinates for d2z8la1.
(The format of our PDB-style files is described here.)

Timeline for d2z8la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z8la2