Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) |
Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins) |
Protein Ribosome recycling factor, RRF [55196] (7 species) |
Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries) |
Domain d2z4l61: 2z4l 6:1-185 [154076] Other proteins in same PDB: d2z4l01, d2z4l11, d2z4l31, d2z4l41, d2z4lc1, d2z4lc2, d2z4ld1, d2z4le1, d2z4lf1, d2z4lg1, d2z4lg2, d2z4lh1, d2z4lh2, d2z4li1, d2z4li2, d2z4lj1, d2z4lk1, d2z4ll1, d2z4lm1, d2z4ln1, d2z4lo1, d2z4lp1, d2z4lq1, d2z4lr1, d2z4ls1, d2z4lt1, d2z4lu1, d2z4lv1, d2z4lw1, d2z4lx1, d2z4ly1, d2z4lz1 automatically matched to d1eh1a_ protein/RNA complex; complexed with mg, par, zn |
PDB Entry: 2z4l (more details), 4.45 Å
SCOPe Domain Sequences for d2z4l61:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z4l61 d.67.3.1 (6:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]} mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke qeilg
Timeline for d2z4l61:
View in 3D Domains from other chains: (mouse over for more information) d2z4l01, d2z4l11, d2z4l31, d2z4l41, d2z4lc1, d2z4lc2, d2z4ld1, d2z4le1, d2z4lf1, d2z4lg1, d2z4lg2, d2z4lh1, d2z4lh2, d2z4li1, d2z4li2, d2z4lj1, d2z4lk1, d2z4ll1, d2z4lm1, d2z4ln1, d2z4lo1, d2z4lp1, d2z4lq1, d2z4lr1, d2z4ls1, d2z4lt1, d2z4lu1, d2z4lv1, d2z4lw1, d2z4lx1, d2z4ly1, d2z4lz1 |