![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
![]() | Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) ![]() duplication: consists of 2 subdomains of this fold |
![]() | Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
![]() | Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries) |
![]() | Domain d2z2lc2: 2z2l C:693-750 [153939] Other proteins in same PDB: d2z2lb1, d2z2le1 automatically matched to d1pmda2 complexed with so4 |
PDB Entry: 2z2l (more details), 2.85 Å
SCOPe Domain Sequences for d2z2lc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z2lc2 d.11.1.1 (C:693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd
Timeline for d2z2lc2:
![]() Domains from other chains: (mouse over for more information) d2z2lb1, d2z2le1, d2z2lf1, d2z2lf2 |