Lineage for d2vqfq1 (2vqf Q:2-105)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059775Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 2060102Protein Ribosomal protein S17 [50304] (3 species)
  7. 2060132Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 2060135Domain d2vqfq1: 2vqf Q:2-105 [153460]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1fjgq_
    complexed with k, mg, par, zn

Details for d2vqfq1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2vqfq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfq1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOPe Domain Coordinates for d2vqfq1:

Click to download the PDB-style file with coordinates for d2vqfq1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfq1: