Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Deoxyribonucleoside kinase [69478] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries) |
Domain d2vp9h_: 2vp9 H: [153420] automated match to d1oe0a_ protein/DNA complex; complexed with doc, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2vp9 (more details), 2.9 Å
SCOPe Domain Sequences for d2vp9h_:
Sequence, based on SEQRES records: (download)
>d2vp9h_ c.37.1.1 (H:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihqrrpqsckvlvldad
>d2vp9h_ c.37.1.1 (H:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihqckvlvldad
Timeline for d2vp9h_: