Lineage for d2vota4 (2vot A:28-219)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942205Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 942351Protein Beta-mannosidase [158959] (1 species)
  7. 942352Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (9 PDB entries)
    Uniprot Q8AAK6 28-219
  8. 942363Domain d2vota4: 2vot A:28-219 [153382]
    Other proteins in same PDB: d2vota1, d2vota2, d2vota3, d2vota5, d2votb1, d2votb2, d2votb3, d2votb5
    automatically matched to 2JE8 A:28-219
    complexed with br, cl, edo, nhv

Details for d2vota4

PDB Entry: 2vot (more details), 1.95 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vota4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vota4 b.18.1.5 (A:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOPe Domain Coordinates for d2vota4:

Click to download the PDB-style file with coordinates for d2vota4.
(The format of our PDB-style files is described here.)

Timeline for d2vota4: