Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries) |
Domain d2vl4a4: 2vl4 A:28-219 [153257] Other proteins in same PDB: d2vl4a1, d2vl4a2, d2vl4a3, d2vl4a5, d2vl4b1, d2vl4b2, d2vl4b3, d2vl4b5, d2vl4b6 automated match to d2je8a4 complexed with br, cl, edo, mnm |
PDB Entry: 2vl4 (more details), 1.9 Å
SCOPe Domain Sequences for d2vl4a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl4a4 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts gvwrpvtlrfyd
Timeline for d2vl4a4: