Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (16 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries) |
Domain d2vl4a1: 2vl4 A:220-330 [153254] Other proteins in same PDB: d2vl4a4, d2vl4a5, d2vl4b4, d2vl4b5, d2vl4b6 automated match to d2je8a1 complexed with br, cl, edo, mnm |
PDB Entry: 2vl4 (more details), 1.9 Å
SCOPe Domain Sequences for d2vl4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl4a1 b.1.4.0 (A:220-330) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl
Timeline for d2vl4a1: