Lineage for d2vina1 (2vin A:16-244)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 954489Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 954490Species Human (Homo sapiens) [TaxId:9606] [50587] (52 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 954507Domain d2vina1: 2vin A:16-244 [153170]
    automatically matched to d1ejna_
    complexed with 505, act, so4

Details for d2vina1

PDB Entry: 2vin (more details), 1.9 Å

PDB Description: fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
PDB Compounds: (A:) urokinase-type plasminogen activator chain b

SCOPe Domain Sequences for d2vina1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vina1 b.47.1.2 (A:16-244) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke

SCOPe Domain Coordinates for d2vina1:

Click to download the PDB-style file with coordinates for d2vina1.
(The format of our PDB-style files is described here.)

Timeline for d2vina1: