Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein) duplication: contains two cytochrome c-type domains |
Protein Di-heme cytochrome c peroxidase [46686] (3 species) |
Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries) |
Domain d2vhda1: 2vhd A:1-164 [153050] automated match to d1eb7a1 complexed with ca, hec |
PDB Entry: 2vhd (more details), 2.3 Å
SCOPe Domain Sequences for d2vhda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhda1 a.3.1.5 (A:1-164) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]} dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlv
Timeline for d2vhda1: