SCOPe 2.02: Domain d2vd1a1: 2vd1 A:76-199

Lineage for d2vd1a1 (2vd1 A:76-199)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class sigma GST [81351] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries)
   Uniprot O60760; synonym: hematopoietic prostaglandin D synthase

8. Domain d2vd1a1: 2vd1 A:76-199 [152962]
   Other proteins in same PDB: d2vd1a2, d2vd1b2, d2vd1c2, d2vd1d2
   automatically matched to d1iyha1
   complexed with d28, gsh, mg

Details for d2vd1a1

PDB Entry: 2vd1, 2.25 Å

PDB Description: complex structure of prostaglandin d2 synthase at 2.25a.

PDB Compounds: (A:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vd1a1:

Sequence; same for both SEQRES and ATOM records:

>d2vd1a1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d2vd1a1:

• d2vd1a1 first appeared in SCOP 1.75
  
• d2vd1a1 appears in SCOPe 2.01
  
• d2vd1a1 appears in SCOPe 2.03
  
• d2vd1a1 appears in the current release, SCOPe 2.08