Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class sigma GST [81351] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries) Uniprot O60760; synonym: hematopoietic prostaglandin D synthase |
Domain d2vd0d1: 2vd0 D:76-199 [152960] Other proteins in same PDB: d2vd0a2, d2vd0b2, d2vd0c2, d2vd0d2 automatically matched to d1iyha1 complexed with d27, gol, gsh |
PDB Entry: 2vd0 (more details), 2.2 Å
SCOPe Domain Sequences for d2vd0d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vd0d1 a.45.1.1 (D:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
Timeline for d2vd0d1: