![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
![]() | Domain d2vczc1: 2vcz C:76-199 [152950] Other proteins in same PDB: d2vcza2, d2vczb2, d2vczc2, d2vczd2 automated match to d1pd211 complexed with gsh, vc3 |
PDB Entry: 2vcz (more details), 1.95 Å
SCOPe Domain Sequences for d2vczc1:
Sequence, based on SEQRES records: (download)
>d2vczc1 a.45.1.1 (C:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp qtkl
>d2vczc1 a.45.1.1 (C:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlagntemeqchvdaivdtlddfmtynaphlmqdldtylggrewlignsvtwadfyweic sttllvfkpdlldnhprlvtlrkkvqaipavanwikrrpqtkl
Timeline for d2vczc1: